Description
TB500 10mg | Thymosin Beta 4 Research Peptide
IMPORTANT: RESEARCH USE ONLY
TB500 (Thymosin Beta 4) is supplied as a lyophilized peptide powder intended exclusively for scientific and laboratory research purposes (Research Use Only, RUO).
This material is not intended for human or veterinary use, human consumption, diagnostic procedures, or therapeutic applications.
Also Known As: TB500, TB-500, Thymosin Beta 4, Thymosin β4, Tβ4
PRODUCT OVERVIEW
TB500 (Thymosin Beta 4) is a 43-amino-acid peptide studied in experimental research for its involvement in actin regulation, cytoskeletal organisation, cellular migration, angiogenic signalling, vascular biology, and cellular signalling pathways.
Thymosin Beta 4 is particularly recognised in research for its interaction with G-actin (globular actin). Actin is an important structural protein involved in maintaining cellular architecture and supporting processes such as cellular movement, migration, division, and intracellular organisation.
Experimental research has investigated Thymosin Beta 4 in connection with cell motility, cytoskeletal dynamics, angiogenesis, vascular signalling, extracellular matrix processes, cellular stress responses, and tissue-remodelling pathways.
Each vial contains 10mg of TB500 (Thymosin Beta 4) in lyophilized form.
RESEARCH BACKGROUND
Thymosin Beta 4 is a naturally occurring peptide that has been identified in numerous mammalian tissues and cell types. It belongs to the beta-thymosin family of peptides and has attracted considerable scientific interest because of its association with actin-dependent cellular processes.
A major area of research concerns the ability of Thymosin Beta 4 to interact with monomeric G-actin, contributing to the regulation of the intracellular actin pool.
The actin cytoskeleton plays an important role in cell shape, cellular movement, migration, adhesion, division, and intracellular organisation. Consequently, regulation of actin dynamics is relevant to numerous areas of molecular and cellular biology.
Research has also explored Thymosin Beta 4 in experimental systems involving vascular biology, angiogenic signalling, extracellular matrix regulation, inflammatory signalling, cell migration, and cellular responses to experimentally induced stress.
These characteristics have made Thymosin Beta 4 a compound of interest in laboratory investigations involving cell biology, molecular signalling, cytoskeletal biology, vascular research, and peptide signalling.
MECHANISM OF RESEARCH INTEREST
One of the principal mechanisms investigated for Thymosin Beta 4 is its interaction with actin.
Thymosin Beta 4 can bind monomeric G-actin and is therefore studied as an actin-sequestering peptide involved in the regulation of actin polymerisation and cytoskeletal dynamics.
Through its relationship with actin-associated processes, researchers have investigated the peptide in connection with cellular migration, cell motility, cytoskeletal reorganisation, and cellular structural responses.
Experimental studies have additionally explored Thymosin Beta 4 in relation to angiogenic signalling, vascular responses, extracellular matrix processes, and molecular pathways associated with cellular stress and tissue remodelling.
The mechanisms associated with Thymosin Beta 4 remain an active area of scientific investigation, and experimental findings can vary according to the research model, methodology, concentration, and experimental conditions.
RESEARCH APPLICATIONS
- Actin regulation research
- G-actin binding investigations
- Cytoskeletal organisation studies
- Cellular migration research
- Cell motility investigations
- Angiogenic signalling research
- Vascular biology studies
- Cellular signalling investigations
- Extracellular matrix research
- Tissue-remodelling pathway studies
- Cellular stress-response research
- Molecular and cellular biology research
- Peptide signalling studies
PRODUCT SPECIFICATIONS
Product Name: TB500
Full Name: Thymosin Beta 4
Active Ingredient: Thymosin Beta 4 (TB500)
CAS Number: 77591-33-4
PubChem CID: 16132341
Peptide Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Peptide Length: 43 amino acids
Molecular Weight: Approximately 4963 g/mol
Appearance: White to off-white lyophilized powder
Physical Form: Lyophilized Powder
Quantity: 10mg per vial
Product Classification: Research Use Only (RUO)
Packaging: Sealed research vial
STORAGE & HANDLING
Long-Term Storage: Store at -20°C in the original sealed container for optimal long-term storage.
Short-Term Storage: Store refrigerated at 2 to -8°C where appropriate for the individual product batch.
Protect from direct light, excessive heat, and moisture.
Keep the vial tightly sealed during storage.
Minimize unnecessary temperature fluctuations.
Avoid repeated freeze-thaw cycles.
After Reconstitution: Store refrigerated at 2 to -8°C, protect from light, and avoid repeated temperature cycling.
Recommended Research Use Period After Reconstitution: Where supported by the product’s batch-specific stability documentation, use the prepared research solution within 28 days when stored under the specified refrigerated conditions.
Batch-specific storage and stability information provided with the product or Certificate of Analysis should take precedence.
RESEARCH SAFETY INFORMATION
TB500 (Thymosin Beta 4) is an experimental research peptide intended for controlled scientific and laboratory investigation.
The material should be handled by appropriately trained personnel using suitable laboratory procedures and personal protective equipment.
Information regarding Thymosin Beta 4 is provided as a summary of areas investigated within scientific research. Research into Thymosin Beta 4 and its biological mechanisms remains ongoing.
Scientific Information Notice: The information provided above is for research reference only. It does not constitute medical advice, dosing guidance, treatment recommendations, or instructions for human use.
REGULATORY & RESEARCH USE NOTICE
FOR RESEARCH USE ONLY. NOT FOR HUMAN OR VETERINARY USE.
This product is intended solely for scientific and laboratory research.
TB500 (Thymosin Beta 4) is not supplied as an approved medicinal product. It is not intended for human consumption, diagnosis, treatment, prevention of disease, or any clinical or therapeutic application.
Purchasers are responsible for ensuring that the purchase, possession, storage, handling, and use of this material comply with all applicable laws, regulations, institutional requirements, and laboratory safety procedures.
Product-specific information, including identity, peptide form, purity, quantity, and batch testing, should be referenced against the relevant Certificate of Analysis (COA).
Images for illustration purposes only.
